Please visit our company webpage on desktop


Czech Republic
CF_logo_grayscaleblog_bgr post_bgrcrediton-cz_logo-screditon-ge_logo-screditon-lv_logo-screditone-sk_logo-slendon-pl_logo-sedu_mapAustriaCanadaCzech RepublicDenmarkFinlandFranceGeorgiaGermanyIrelandIsraelItalyLatviaPolandRussiaSlovakiaSwedenUkraineUnited KingdomUnited States1_page_network NETWORK active_customersaverage_ageAge< 25Age25/33Age33/41Age41/49Age49/57Age57/65Age65 +22 %31 %20 %13 %7 %4 %3 %average_height198cmTALLEST PERSON155cmSHORTEST PERSON176cmAVERAGE HEIGHTcompany_statsAustriaCanadaCzech RepublicDenmarkFinlandFranceGeorgiaGermanyIrelandIsraelItalyLatviaPolandRussiaSlovakiaSwedenUkraineUnited KingdomUnited Statescompany_stats_oldISRAELGEORGIACANADAUSAGERMANYCZECH REPUBLICDENMARKSWEDENFINLANDLATVIARUSSIAUKRAINEPOLANDIRLANDFRANCEUNITED KINGDOMAUSTRIASLOVAKIAITALYcream_finance_universe_imgemployee_gender_distributiongender55%45%hobbies_curious_facts41% SPORT20% MUSIC19% OTHER13% ART16% TRAVEL10% BOOKS9% MOTOR SPORTS4% GAMING72%OF EMPLOYEESHAVE DONE SOCIALLYRESPONSIBLEACTIVITIESIN THE PASTYEAR67%EARLYBIRDS33%NIGHTOWLSlaptops_vs_desktops_in_our_offices 37% LAPTOPS 63% DESKTOPS 78% Linux- users Mac- users 11% 11% Windows- users loan_aprove31%88% Infografika_20.06 mony_vs_timeMONEYVSTIMEprinciple_lent_in020102011201220142013€ 1 000 000€ 2 000 000€ 3 000 000€ 4 500 000total_customers_with_loanstotal_registered_customers invest_bgr_1invest_bgr_2invest_bgr_3invest_picture Principle lent in € 0 2010 2011 2012 2014 2013 € 1,0 M € 2,0 M € 3,0 M € 4,5 M jobjob_picture49%MEN51%WOMEN28AVERAGEAGE2_page_fintech TECHNOLOGY FINANCE 2_page_fintech_2consumer_signinternet_signlending_signfacebook linked_in share-facebook share-linkedin twitter vk knowledge_map

Job opportunities

In Creamfinance, we believe in diversity and the synergy it brings. We have early birds and night owls, scuba divers and bookworms, Windows-users, Linux-geeks, and Mac-aficionados, musicians, gamers and dancers, polyglots, math teachers, fire safety specialists and rifle-lovers. Each competence enriches the hive.

Creamfinance offers a number of attractive job opportunities. Can you contribute to our mutual success? We give encouraging financial rewards for real progress. We value diversity, communication and strive for improvement.


Image for Job opportunities

Current vacancies

Front-End UX Designer

CreamWise – a digital credit broker in the US for the companies within the CreamFinance group. The main focus of the company is an execution of digital advertising. The company will in particular: implement and execute the group marketing strategy cooperate on the global /local level with marketing vendors, negotiate contracts,  take care of the unified Group frontend and the brand of the Group.



  • Develop and implement front-end from UX perspective
  • Design wireframes and mockups to revamp existing front-ends
  • Collaborate with marketing teammates, senior management, designers, developers and other project stakeholders inside and outside of the organisation in several countries across the globe
  • Proactively scope and present new ideas to improve our website experience for prospects, leads, and customers
  • Drive user research and concept development, including persona and scenario development
  • Design studies that address both user behaviour and attitudes, and generate actionable insights
  • Advocate for the user throughout the process of proposing, wireframing and implementing UX improvements
  • Collaborate with Client to support website design and content marketing (blog, social media assets, and more)
  • Bring new ideas for design and content creation to the team
  • Scope and create templates for Client to be more efficient in some of their posting on social media, the blog, email, and other channels
  • Support the execution of designs in several product teams to Client’s order
  • Looking for the new trends, tools in the market which help to improve the UX



  • Wide experience in human-computer interaction or related discipline
  • Past work either as an in-house designer or at a marketing agency (we require work samples to apply for this position)
  • Several years of experience from UX design practices and a strong portfolio with design aesthetics
  • Strong background in creating wireframes, storyboards, user flows, process flows and sitemaps
  • Up-to-date knowledge of the latest UX trends, tools, techniques and technologies
  • Personal interest in staying up-to-date on the latest trends, including agile methodology and emerging best practices in the UX community
  • Knowledge of UI will be an additional asset
  • Experience in working within an Agile/Scrum development process and according to human-centred design methods will be an additional asset
  • Domain expertise in UI/UX best practices
  • In-depth understanding of UX/UI design, including knowing how and when to leverage research and testing to inform decisions
  • Advanced knowledge of Photoshop or another graphic design programme, Adobe Creative Suite (or similar technology)
  • Knowledge of flash/animation tools will be an asset (eg. Pixate, Principle)
  • Excellent communicator, both verbal and written
  • Excellent written and spoken communication skills in English

We offer:

  • Part-time or full-time job with a job contract
  • Work in a fast-growing organisation
  • International work environment


Please complete the following form to apply for a position with Creamfinance.